Timetoast
  • Product

    • Privacy & Sharing

      Keep drafts private, then share, publish, or embed with confidence.

    • Dynamic Views

      Move between horizontal, vertical, and grid views to suit the task.

    • Custom Fields & Grouping

      Add custom fields, color-code events, and compare grouped lanes.

    • Collaboration

      Invite teammates, assign roles, and avoid version confusion.

    • Date Handling

      Handle chronology more accurately when standard date tools fall short.

    • Timeline Templates

      Quick-start timeline projects with pre-built templates.

  • Solutions

    • Roadmapping

      Keep product and project roadmaps easier to review and explain.

    • Project Management

      Align teams around one clear plan without heavy PM overhead.

    • History

      Create history timelines that make sequence and context easier to see.

    • Education

      Use timelines for lessons, projects, and classroom explanations.

    • Biographies

      Highlight milestones, patterns, and context across a life story.

    • Legal Cases

      Organize events, evidence, and deadlines in one timeline.

  • Resources

    • Help Center

      Find answers and support for your questions.
    • The Timetoast Blog

      Read the latest news and updates.
    • About

      Learn more about who we are and what we do.
    • Contact Us

      Get in touch. Report bugs, suggest features, or ask questions.

    Published Timelines

    Search Published Timelines

    Search through published timelines on Timetoast.
    • Timeline Categories

      Browse timelines by category.
    • Popular timelines

      Widely viewed and shared content.
  • Sign in
  • Pricing + Sign up

Updated Timelines

ETAPES DE LA 1a GUERRA MUNDIAL
Monarcas de Inglaterra en la edad moderna
literatura gazte
Timeline: literatura gazte
Reinado Carlos V
Eje Cronolico
Monarcas de Inglaterra
Carlos V Línea del tiempo
Timeline: Carlos V Línea del tiempo
Línea del tiempo Carlos V
Timeline: Línea del tiempo Carlos V
Artistas canarios
Práctica 2
Pintores canarios de siglo 20
Renessanse - Barokk - Opplysningstid
Odaát c. Sorozat évadainak megjelenése
Timeline: Odaát c. Sorozat évadainak megjelenése
Tema 9 y 10
Timeline: Tema 9 y 10
mblblibgkuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuopihseifhqpiewfhlkefqiefhqpksbqkefhqpiefhqshqwf...
Timeline: mblblibgkuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuopihseifhqpiewfhlkefqiefhqpksbqkefhqpiefhqshqwfigqsikbqkwfbqiowfgoiwfhbqilwfigqwoifgqasojcbqwoufbqeifyqipfhqwklfaipyqwefihqiqwhfqøwfbqkwfhweifgqscgqwoifhasohqiwfhqoishqiwfhqlksclqwnaisuqwifhqsaqlwkfogfqlwf
2.verdenskrig
‹ Prev … 12331 12332 12333 12334 12335 12336 12337 12338 12339 … Next ›

Product

  • Privacy & Sharing
  • Multiple Views
  • Custom Fields & Grouping
  • Collaboration
  • Date Handling
  • Timeline Templates

Solutions

  • Roadmapping
  • Project Management
  • History
  • Education
  • Biographies
  • Legal Cases

Resources

  • Help Center
  • Blog
  • About
  • Contact

Browse

  • Timeline Categories
  • Popular Timelines
  • Updated Timelines
  • Latest Timelines
  • Privacy
  • Terms
  • Cookies Policy
Copyright © 2007-2026 Timetoast Timelines, All rights reserved. Made with ❤️ in London.
Filter 2 Streamline Icon: https://streamlinehq.comLayout Left Sidebar Streamline Icon: https://streamlinehq.comAnnouncement Megaphone Streamline Icon: https://streamlinehq.com